PDB entry 1xo9

View 1xo9 on RCSB PDB site
Description: Solution Structure of AT3g03773 from Arabidopsis Thaliana
Deposited on 2004-10-06, released 2004-10-19
The last revision was dated 2007-01-09, with a file datestamp of 2013-04-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein At3g03773
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed):
    • GB AAT68743 (0-149)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xo9A (A:)
    msrnpevlwaqrsdkvyltvalpdakdisvkcepqglfsfsalgaqgerfefslelygki
    mteyrknvglrniifsiqkeerswwtrllkseekpapyikvdwnkwcdedeevnsetasd
    desafvnqdsessdddgllylpdlekarnk