PDB entry 1xo7

View 1xo7 on RCSB PDB site
Description: Crystal structure of cyclophilin from Trypanosoma cruzi
Class: isomerase
Keywords: cyclophilin, rotamase, proline, isomerase, cis-trans, trypanosoma, cruzi, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, STRUCTURAL GENOMICS OF PATHOGENIC PROTOZOA CONSORTIUM, SGPP
Deposited on 2004-10-05, released 2004-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.18
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xo7a_
  • Chain 'B':
    Compound: cyclophilin
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xo7b_
  • Chain 'C':
    Compound: cyclophilin
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xo7c_
  • Chain 'D':
    Compound: cyclophilin
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xo7d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xo7A (A:)
    mpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvir
    nfmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttapt
    pwldgrhvvfgkvvegmdvvkkventktglndkpkkavkindcgvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xo7B (B:)
    mpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvir
    nfmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttapt
    pwldgrhvvfgkvvegmdvvkkventktglndkpkkavkindcgvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xo7C (C:)
    mpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvir
    nfmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttapt
    pwldgrhvvfgkvvegmdvvkkventktglndkpkkavkindcgvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xo7D (D:)
    mpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvir
    nfmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttapt
    pwldgrhvvfgkvvegmdvvkkventktglndkpkkavkindcgvl