PDB entry 1xo6

View 1xo6 on RCSB PDB site
Description: Acyl-CoA Carboxylase Beta Subunit from S. coelicolor (PccB), apo form #3
Class: ligase
Keywords: polyketide; polyketide synthase; acyl-CoA carboxylase; carboxyltransferase, LIGASE
Deposited on 2004-10-05, released 2004-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: propionyl-CoA carboxylase complex B subunit
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xo6a1, d1xo6a2
  • Chain 'B':
    Compound: propionyl-CoA carboxylase complex B subunit
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xo6b1, d1xo6b2
  • Chain 'C':
    Compound: propionyl-CoA carboxylase complex B subunit
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xo6c1, d1xo6c2
  • Chain 'D':
    Compound: propionyl-CoA carboxylase complex B subunit
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xo6d1, d1xo6d2
  • Chain 'E':
    Compound: propionyl-CoA carboxylase complex B subunit
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xo6e1, d1xo6e2
  • Chain 'F':
    Compound: propionyl-CoA carboxylase complex B subunit
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xo6f1, d1xo6f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xo6A (A:)
    msepeeqqpdihttagkladlrrrieeathagsaravekqhakgkltareridllldegs
    fveldefarhrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqk
    ivkvmdfalktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpc
    aggavyspaitdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhm
    agdekdaveyvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhs
    viehvlddaeffetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfv
    rtcdafnvpvltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafgga
    ydvmgskhlgadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyeda
    llnpytaaergyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xo6A (A:)
    dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
    hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
    ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
    itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
    yvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhsviehvldda
    effetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfvrtcdafnvp
    vltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafggaydvmgskhl
    gadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyedallnpytaae
    rgyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xo6B (B:)
    msepeeqqpdihttagkladlrrrieeathagsaravekqhakgkltareridllldegs
    fveldefarhrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqk
    ivkvmdfalktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpc
    aggavyspaitdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhm
    agdekdaveyvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhs
    viehvlddaeffetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfv
    rtcdafnvpvltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafgga
    ydvmgskhlgadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyeda
    llnpytaaergyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xo6B (B:)
    dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
    hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
    ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
    itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
    yvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhsviehvldda
    effetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfvrtcdafnvp
    vltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafggaydvmgskhl
    gadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyedallnpytaae
    rgyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xo6C (C:)
    msepeeqqpdihttagkladlrrrieeathagsaravekqhakgkltareridllldegs
    fveldefarhrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqk
    ivkvmdfalktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpc
    aggavyspaitdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhm
    agdekdaveyvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhs
    viehvlddaeffetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfv
    rtcdafnvpvltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafgga
    ydvmgskhlgadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyeda
    llnpytaaergyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xo6C (C:)
    dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
    hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
    ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
    itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
    yvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhsviehvldda
    effetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfvrtcdafnvp
    vltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafggaydvmgskhl
    gadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyedallnpytaae
    rgyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xo6D (D:)
    msepeeqqpdihttagkladlrrrieeathagsaravekqhakgkltareridllldegs
    fveldefarhrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqk
    ivkvmdfalktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpc
    aggavyspaitdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhm
    agdekdaveyvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhs
    viehvlddaeffetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfv
    rtcdafnvpvltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafgga
    ydvmgskhlgadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyeda
    llnpytaaergyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xo6D (D:)
    dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
    hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
    ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
    itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
    yvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhsviehvldda
    effetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfvrtcdafnvp
    vltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafggaydvmgskhl
    gadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyedallnpytaae
    rgyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xo6E (E:)
    msepeeqqpdihttagkladlrrrieeathagsaravekqhakgkltareridllldegs
    fveldefarhrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqk
    ivkvmdfalktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpc
    aggavyspaitdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhm
    agdekdaveyvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhs
    viehvlddaeffetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfv
    rtcdafnvpvltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafgga
    ydvmgskhlgadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyeda
    llnpytaaergyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xo6E (E:)
    dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
    hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
    ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
    itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
    yvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhsviehvldda
    effetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfvrtcdafnvp
    vltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafggaydvmgskhl
    gadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyedallnpytaae
    rgyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xo6F (F:)
    msepeeqqpdihttagkladlrrrieeathagsaravekqhakgkltareridllldegs
    fveldefarhrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqk
    ivkvmdfalktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpc
    aggavyspaitdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhm
    agdekdaveyvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhs
    viehvlddaeffetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfv
    rtcdafnvpvltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafgga
    ydvmgskhlgadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyeda
    llnpytaaergyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xo6F (F:)
    dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
    hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
    ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
    itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
    yvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhsviehvldda
    effetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfvrtcdafnvp
    vltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafggaydvmgskhl
    gadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyedallnpytaae
    rgyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl