PDB entry 1xo5

View 1xo5 on RCSB PDB site
Description: Crystal structure of CIB1, an EF-hand, integrin and kinase-binding protein
Class: calcium-binding protein
Keywords: Calcium and Integrin binding, EF-hand, Kinase Interacting Protein, calmyrin, calcium-binding protein
Deposited on 2004-10-05, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium and integrin-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CIB1, PRKDCIP, KIP, CIB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99828 (Start-182)
      • conflict (35)
    Domains in SCOPe 2.07: d1xo5a_
  • Chain 'B':
    Compound: Calcium and integrin-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CIB1, PRKDCIP, KIP, CIB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99828 (Start-182)
      • conflict (35)
    Domains in SCOPe 2.07: d1xo5b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xo5A (A:)
    skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
    fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
    srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
    ivl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xo5A (A:)
    llaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanpfke
    ricrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredlsrl
    vncltrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfkivl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xo5B (B:)
    skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
    fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
    srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
    ivl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xo5B (B:)
    llaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanpfke
    ricrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredlsrl
    vnclasemkqlidnileesdidrdgtinlsefqhvisrspdfassfkivl