PDB entry 1xo3

View 1xo3 on RCSB PDB site
Description: Solution Structure of Ubiquitin like protein from Mus Musculus
Deposited on 2004-10-05, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xo3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xo3A (A:)
    saaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllkerpelfiqg
    dsvrpgilvlindadwellgeldyqlqdqdsilfistlhgg