PDB entry 1xo2

View 1xo2 on RCSB PDB site
Description: Crystal structure of a human cyclin-dependent kinase 6 complex with a flavonol inhibitor, fisetin
Class: cell cycle/transferase
Keywords: crystal structure,human cyclin-dependent kinase 6, fisetin, CELL CYCLE-TRANSFERASE COMPLEX
Deposited on 2004-10-05, released 2005-03-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.26
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclin
    Species: Saimiriine herpesvirus 2 [TaxId:10381]
    Gene: 72, ECLF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xo2a1, d1xo2a2
  • Chain 'B':
    Compound: cell division protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xo2b_
  • Heterogens: FSE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xo2A (A:)
    madspnrlnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmh
    llcesfeldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvsklt
    ylscdcftnlelinqekdilealkwdteavlatdfliplcnalkipedlwpqlyeaastt
    ickaliqpniallspglicaggllttietdntncrpwtcyledlssilnfstntvrtvkd
    qvseafslydleil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xo2A (A:)
    nrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfel
    dksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnle
    linqekdilealkwdteavlatdfliplcnalkipedlwpqlyeaasttickaliqpnia
    llspglicaggllttietdntncrpwtcyledlssilnfstntvrtvkdqvseafslydl
    eil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xo2B (B:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qdlercke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xo2B (B:)
    qqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhlet
    fehpnvvrlfdvctvsretkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgl
    dflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapevllq
    ssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdvalprqa
    fhaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfqdler