PDB entry 1xnz

View 1xnz on RCSB PDB site
Description: Crystal Structure of Mn(II) form of E. coli. Methionine Aminopeptidase in complex with 5-(2-chlorophenyl)furan-2-carboxylic acid
Class: hydrolase
Keywords: Methionine Aminopeptidase, structure, complex, inhibitor
Deposited on 2004-10-05, released 2004-11-02
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.219
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnza_
  • Heterogens: MN, NA, FCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xnzA (A:)
    maisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsacl
    gyhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkpti
    mgerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfhee
    pqvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivv
    tdngceiltlrkddtipaiishde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnzA (A:)
    aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
    yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
    gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
    qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
    dngceiltlrkddtipaiishd