PDB entry 1xnx

View 1xnx on RCSB PDB site
Description: crystal structure of constitutive androstane receptor
Deposited on 2004-10-05, released 2005-01-04
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-04, with a file datestamp of 2005-01-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.229
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xnxa_
  • Chain 'B':
    Domains in SCOP 1.71: d1xnxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xnxA (A:)
    hhhhhhaekaslqlnqqqkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprg
    pvlpllthfadintfmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfcl
    qtenffcgplcykmedavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdr
    pgvtqreeidqlqeemalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqr
    leelsamtpllgeics
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnxA (A:)
    lqlnqqqkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfad
    intfmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplc
    ykmedavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidq
    lqeemalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrlee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xnxB (B:)
    hhhhhhaekaslqlnqqqkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprg
    pvlpllthfadintfmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfcl
    qtenffcgplcykmedavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdr
    pgvtqreeidqlqeemalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqr
    leelsamtpllgeics
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnxB (B:)
    qkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfadintfmv
    qqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykmeda
    vhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqeema
    lilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrltpllgeic