PDB entry 1xnx

View 1xnx on RCSB PDB site
Description: Crystal structure of constitutive androstane receptor
Class: ligand receptor/transcription regulation
Keywords: nuclear receptor; crystal structure, LIGAND RECEPTOR-TRANSCRIPTION REGULATION COMPLEX
Deposited on 2004-10-05, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: constitutive androstane receptor
    Species: Mus musculus [TaxId:10090]
    Gene: Nr1i3, Car
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xnxa_
  • Chain 'B':
    Compound: constitutive androstane receptor
    Species: Mus musculus [TaxId:10090]
    Gene: Nr1i3, Car
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xnxb_
  • Heterogens: ATE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xnxA (A:)
    hhhhhhaekaslqlnqqqkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprg
    pvlpllthfadintfmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfcl
    qtenffcgplcykmedavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdr
    pgvtqreeidqlqeemalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqr
    leelsamtpllgeics
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnxA (A:)
    lqlnqqqkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfad
    intfmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplc
    ykmedavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidq
    lqeemalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrlee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xnxB (B:)
    hhhhhhaekaslqlnqqqkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprg
    pvlpllthfadintfmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfcl
    qtenffcgplcykmedavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdr
    pgvtqreeidqlqeemalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqr
    leelsamtpllgeics
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnxB (B:)
    qkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfadintfmv
    qqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykmeda
    vhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqeema
    lilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrltpllgeic