PDB entry 1xnv

View 1xnv on RCSB PDB site
Description: Acyl-CoA Carboxylase Beta Subunit from S. coelicolor (PccB), apo form #1
Class: ligase
Keywords: polyketide; polyketide synthase; acyl-CoA carboxylase; carboxyltransferase, LIGASE
Deposited on 2004-10-05, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: propionyl-CoA carboxylase complex B subunit
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xnva1, d1xnva2
  • Chain 'B':
    Compound: propionyl-CoA carboxylase complex B subunit
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xnvb1, d1xnvb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xnvA (A:)
    msepeeqqpdihttagkladlrrrieeathagsaravekqhakgkltareridllldegs
    fveldefarhrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqk
    ivkvmdfalktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpc
    aggavyspaitdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhm
    agdekdaveyvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhs
    viehvlddaeffetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfv
    rtcdafnvpvltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafgga
    ydvmgskhlgadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyeda
    llnpytaaergyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnvA (A:)
    dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
    hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
    ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
    itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
    yvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhsviehvldda
    effetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfvrtcdafnvp
    vltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafggaydvmgskhl
    gadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyedallnpytaae
    rgyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xnvB (B:)
    msepeeqqpdihttagkladlrrrieeathagsaravekqhakgkltareridllldegs
    fveldefarhrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqk
    ivkvmdfalktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpc
    aggavyspaitdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhm
    agdekdaveyvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhs
    viehvlddaeffetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfv
    rtcdafnvpvltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafgga
    ydvmgskhlgadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyeda
    llnpytaaergyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnvB (B:)
    dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
    hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
    ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
    itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
    yvkqllsylpsnnlseppafpeeadlavtdedaeldtivpdsanqpydmhsviehvldda
    effetqplfapniltgfgrvegrpvgivanqpmqfagclditasekaarfvrtcdafnvp
    vltfvdvpgflpgvdqehdgiirrgaklifayaeatvplitvitrkafggaydvmgskhl
    gadlnlawptaqiavmgaqgavnilhrrtiadagddaeatrarliqeyedallnpytaae
    rgyvdavimpsdtrrhivrglrqlrtkreslppkkhgnipl