PDB entry 1xns

View 1xns on RCSB PDB site
Description: Peptide trapped Holliday junction intermediate in Cre-loxP recombination
Class: Hydrolase, Ligase/DNA
Keywords: CRE Recombinase, holliday junction, recombination, complex (recombinase/DNA), peptide inhibitor, Hydrolase, Ligase/DNA COMPLEX
Deposited on 2004-10-05, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Recombinase cre
    Species: Enterobacteria phage P1 [TaxId:10678]
    Gene: cre
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xnsa1, d1xnsa2
  • Chain 'B':
    Compound: Recombinase cre
    Species: Enterobacteria phage P1 [TaxId:10678]
    Gene: cre
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xnsb1, d1xnsb2
  • Chain 'C':
    Compound: LoxP DNA
  • Chain 'D':
    Compound: LoxP DNA
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xnsA (A:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnsA (A:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xnsB (B:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnsB (B:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.