PDB entry 1xnr

View 1xnr on RCSB PDB site
Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center
Class: ribosome
Keywords: ribosome, translation, decoding, 30S, tRNA modification
Deposited on 2004-10-05, released 2004-12-14
The last revision prior to the SCOP 1.75 freeze date was dated 2004-12-14, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.227
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16S ribosomal RNA
    Species: Thermus thermophilus
    Gene:
  • Chain 'B':
    Compound: 16S Ribosomal protein S2
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrb_
  • Chain 'C':
    Compound: 16S Ribosomal protein S3
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrc1, d1xnrc2
  • Chain 'D':
    Compound: 16S Ribosomal protein S4
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrd_
  • Chain 'E':
    Compound: 16S Ribosomal protein S5
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnre1, d1xnre2
  • Chain 'F':
    Compound: 16S Ribosomal protein S6
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrf_
  • Chain 'G':
    Compound: 16S Ribosomal protein S7
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrg_
  • Chain 'H':
    Compound: 16S Ribosomal protein S8
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrh_
  • Chain 'I':
    Compound: 16S Ribosomal protein S9
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnri_
  • Chain 'J':
    Compound: 16S Ribosomal protein S10
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrj_
  • Chain 'K':
    Compound: 16S Ribosomal protein S11
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrk_
  • Chain 'L':
    Compound: 16S Ribosomal protein S12
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB CAA36418
    Domains in SCOP 1.75: d1xnrl_
  • Chain 'M':
    Compound: 16S Ribosomal protein S13
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrm_
  • Chain 'N':
    Compound: 16S Ribosomal protein S14
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrn_
  • Chain 'O':
    Compound: 16S Ribosomal protein S15
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnro_
  • Chain 'P':
    Compound: 16S Ribosomal protein S16
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrp_
  • Chain 'Q':
    Compound: 16S Ribosomal protein S17
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrq_
  • Chain 'R':
    Compound: 16S Ribosomal protein S18
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrr_
  • Chain 'S':
    Compound: 16S Ribosomal protein S19
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrs_
  • Chain 'T':
    Compound: 16S Ribosomal protein S20
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrt_
  • Chain 'V':
    Compound: 16S Ribosomal protein THX
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xnrv_
  • Chain 'W':
    Compound: mRNA
    Species:
    Gene:
  • Chain 'X':
    Compound: Anticodon tRNA
    Species:
    Gene:
  • Heterogens: PAR, MG, ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xnrB (B:)
    mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfied
    lamrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelea
    lfaspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearkl
    fipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    eaeatetpegesevea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrB (B:)
    vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
    tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
    ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
    ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xnrC (C:)
    mgnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdiera
    adnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrv
    aeqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlra
    nidygfalarttygvlgvkayiflgeviggqkpkarpelpkaeerprrrrpavrvkkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrC (C:)
    gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
    dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
    eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
    idygfalarttygvlgvkayiflgev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xnrD (D:)
    mgryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlre
    kqklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarql
    vrhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldveg
    mkgkflrlpdredlalpvneqlviefysr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrD (D:)
    gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
    qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
    rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
    kgkflrlpdredlalpvneqlviefysr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xnrE (E:)
    mpetdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagy
    yarrnmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdilt
    kelgsrnpiniayatmealrqlrtkadverlrkgeahaqaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrE (E:)
    dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
    nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
    srnpiniayatmealrqlrtkadverlrkg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xnrF (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xnrG (G:)
    marrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplk
    vfkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavri
    ahelmdaaegkggavkkkedvermaeanrayahyrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrG (G:)
    arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
    fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
    helmdaaegkggavkkkedvermaeanrayahyrw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xnrH (H:)
    mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
    vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
    drearklgvggelicevw
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1xnrI (I:)
    meqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfd
    ayitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkar
    rapqyskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrI (I:)
    eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
    yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
    apqyskr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1xnrJ (J:)
    mpkiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsr
    ehfelrthnrlvdiinpnrktieqlmtldlptgveieiktvgggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrJ (J:)
    kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
    felrthnrlvdiinpnrktieqlmtldlptgveieikt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1xnrK (K:)
    makkpskkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpya
    aqlaaldaakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcr
    pkkkfrkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrK (K:)
    krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
    kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1xnrL (L:)
    mvalptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrl
    tsgyevtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrsky
    gtkkpkeaaktaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrL (L:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1xnrM (M:)
    mariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyv
    entwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagk
    kkaprk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrM (M:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
    kaprk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1xnrN (N:)
    markaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkas
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrN (N:)
    arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1xnrO (O:)
    mpitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmv
    gqrrrllrylqredperyralieklgirg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrO (O:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1xnrP (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqearega
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrP (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqe
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1xnrQ (Q:)
    mpkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveii
    esrpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrQ (Q:)
    pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
    srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1xnrR (R:)
    mstknakpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsg
    keqrilaktikrarilgllpfteklvrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrR (R:)
    psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
    lgllpfteklvrk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1xnrS (S:)
    mprslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpv
    yitenmvghklgefaptrtyrghgkeakatkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrS (S:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1xnrT (T:)
    maqkkpkrnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkae
    slidkaakgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrT (T:)
    rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
    kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1xnrV (V:)
    mgkgdrrtrrgkiwrgtygkyrprkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnrV (V:)
    gkgdrrtrrgkiwrgtygkyrprk
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.