PDB entry 1xnn

View 1xnn on RCSB PDB site
Description: crystal structure of the rat androgen receptor ligand binding domain t877a mutant complex with (3a-alpha-,4-alpha 7-alpha-,7a-alpha-)-3a,4,7,7a-tetrahydro-2-(4-nitro-1-naphthalenyl)-4,7-ethano-1h-isoindole-1,3(2h)-dione.
Class: hormone/growth factor
Keywords: androgen receptor, steroid receptor, nuclear receptor, transcription regulation, ligand-binding domain, hormone/growth factor complex
Deposited on 2004-10-05, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.249
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ar, Nr3c4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15207
      • engineered (217)
    Domains in SCOPe 2.07: d1xnna_
  • Heterogens: HYQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xnnA (A:)
    gshmiegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwa
    kalpgfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksr
    mysqcvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeld
    riiackrknptscsrrfyqltklldsvqpiarelhqfafdllikshmvsvdfpemmaeii
    svqvpkilsgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnnA (A:)
    iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
    dqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
    qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpts
    csrrfyqltklldsvqpiarelhqfafdllikshmvsvdfpemmaeiisvqvpkilsgkv
    kpiyfht