PDB entry 1xnk

View 1xnk on RCSB PDB site
Description: Beta-1,4-xylanase from Chaetomium thermophilum complexed with methyl thioxylopentoside
Class: hydrolase
Keywords: xylanase, glycoside hydrolase, family 11, glycosidase, thioinhibitor, sulphur containing inhibitor, HYDROLASE
Deposited on 2004-10-05, released 2005-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoxylanase 11A
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J1V6 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1xnka_
  • Chain 'B':
    Compound: endoxylanase 11A
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J1V6 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1xnkb_
  • Heterogens: SO4, XS2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xnkA (A:)
    etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
    inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
    tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
    yssgsatvnvggsttg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnkA (A:)
    etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
    inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
    tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
    yssgsatvnvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xnkB (B:)
    etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
    inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
    tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
    yssgsatvnvggsttg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnkB (B:)
    etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
    inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
    tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
    yssgsatvnvg