PDB entry 1xni

View 1xni on RCSB PDB site
Description: Tandem Tudor Domain of 53BP1
Class: cell cycle
Keywords: beta-barrel, bent beta-sheet, CELL CYCLE
Deposited on 2004-10-05, released 2004-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.247
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor suppressor p53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xnia1, d1xnia2
  • Chain 'B':
    Compound: tumor suppressor p53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xnib1, d1xnib2
  • Chain 'C':
    Compound: tumor suppressor p53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xnic1, d1xnic2
  • Chain 'D':
    Compound: tumor suppressor p53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xnid1, d1xnid2
  • Chain 'E':
    Compound: tumor suppressor p53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xnie1, d1xnie2
  • Chain 'F':
    Compound: tumor suppressor p53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xnif1, d1xnif2
  • Chain 'G':
    Compound: tumor suppressor p53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xnig1, d1xnig2
  • Chain 'H':
    Compound: tumor suppressor p53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xnih1, d1xnih2
  • Chain 'I':
    Compound: tumor suppressor p53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xnii1, d1xnii2
  • Chain 'J':
    Compound: tumor suppressor p53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xnij1, d1xnij2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xniA (A:)
    sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
    talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqygl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xniB (B:)
    sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
    talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqygl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xniC (C:)
    sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
    talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqygl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xniD (D:)
    sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
    talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqygl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xniE (E:)
    sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
    talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqygl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xniF (F:)
    sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
    talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqygl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xniG (G:)
    sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
    talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqygl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xniH (H:)
    sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
    talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqygl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xniI (I:)
    sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
    talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqygl
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xniJ (J:)
    sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
    talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqygl