PDB entry 1xng

View 1xng on RCSB PDB site
Description: Crystal Structure of NH3-dependent NAD+ synthetase from Helicobacter pylori
Class: ligase
Keywords: NH3-dependent NAD+ synthetase, Helicobacter pylori, amidotransferase, LIGASE
Deposited on 2004-10-05, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.229
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nh(3)-dependent nad(+) synthetase
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xnga1
  • Chain 'B':
    Compound: nh(3)-dependent nad(+) synthetase
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25096 (Start-259)
      • cloning artifact (260-263)
    Domains in SCOPe 2.07: d1xngb2, d1xngb3
  • Heterogens: MG, DND, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xngA (A:)
    mqkdyqklivylcdflekevqkrgfkkvvyglsggldsavvgvlcqkvfkenahallmps
    svsmpenktdalnlcekfsipyteysiapydaifsshfkdasltrkgnfcarlrmaflyd
    yslksdslvigtsnksermlgygtlfgdlacainpigelfktevyelarrlnipkkilnk
    ppsadlfvgqsdekdlgypysvidpllkdiealfqtkpidtetlaqlgydeilvknitsr
    iqknafklelpaiakrfnpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xngA (A:)
    kdyqklivylcdflekevqkrgfkkvvyglsggldsavvgvlcqkvfkenahallmpssv
    smpenktdalnlcekfsipyteysiapydaifsshfkdasltrkgnfcarlrmaflydys
    lksdslvigtsnksermlgygtlfgdlacainpigelfktevyelarrlnipkkilnkpp
    sadlfvgqsdekdlgypysvidpllkdiealfqtkpidtetlaqlgydeilvknitsriq
    knafklelpaiakrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xngB (B:)
    mqkdyqklivylcdflekevqkrgfkkvvyglsggldsavvgvlcqkvfkenahallmps
    svsmpenktdalnlcekfsipyteysiapydaifsshfkdasltrkgnfcarlrmaflyd
    yslksdslvigtsnksermlgygtlfgdlacainpigelfktevyelarrlnipkkilnk
    ppsadlfvgqsdekdlgypysvidpllkdiealfqtkpidtetlaqlgydeilvknitsr
    iqknafklelpaiakrfnpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xngB (B:)
    kdyqklivylcdflekevqkrgfkkvvyglsggldsavvgvlcqkvfkenahallmpssv
    smpenktdalnlcekfsipyteysiapydaifsshfkdasltrkgnfcarlrmaflydys
    lksdslvigtsnksermlgygtlfgdlacainpigelfktevyelarrlnipkkilnkpp
    sadlfvgqsdekdlgypysvidpllkdiealfqtkpidtetlaqlgydeilvknitsriq
    knafklelpaiakrfnpelehh