PDB entry 1xnf

View 1xnf on RCSB PDB site
Description: Crystal structure of E.coli TPR-protein NlpI
Class: Structural genomics, Unknown function
Keywords: NlpI, TPR, tetratricopeptide, lipoprotein, Structural genomics, Unknown function
Deposited on 2004-10-04, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.171
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein nlpI
    Species: Escherichia coli [TaxId:562]
    Gene: nlpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39833
      • modified residue (27)
      • modified residue (75)
      • modified residue (196)
    Domains in SCOPe 2.07: d1xnfa_
  • Chain 'B':
    Compound: Lipoprotein nlpI
    Species: Escherichia coli [TaxId:562]
    Gene: nlpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39833
      • modified residue (27)
      • modified residue (75)
      • modified residue (196)
    Domains in SCOPe 2.07: d1xnfb_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xnfA (A:)
    sntswrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglra
    larndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgia
    lyyggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwg
    wnivefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfkl
    avannvhnfvehryallelsllgqdqddlaesdqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnfA (A:)
    ksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglralarndf
    sqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgialyyggr
    dklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgwnivef
    ylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfklavannv
    hnfvehryallelsllgqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xnfB (B:)
    sntswrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglra
    larndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgia
    lyyggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwg
    wnivefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfkl
    avannvhnfvehryallelsllgqdqddlaesdqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnfB (B:)
    swrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglralar
    ndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgialyy
    ggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgwni
    vefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfklava
    nnvhnfvehryallelsllgqd