PDB entry 1xnd

View 1xnd on RCSB PDB site
Description: high-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis
Class: glycosidase
Keywords: glycosidase
Deposited on 1994-06-01, released 1994-12-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: Hypocrea lixii [TaxId:5544]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xnda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xndA (A:)
qtigpgtgysngyyysywndghagvtytnggggsftvnwsnsgnfvagkgwqpgtknkvi
nfsgsynpngnsylsiygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawashgltlgtmdyqivavegyf
ssgsasitvs