PDB entry 1xnc

View 1xnc on RCSB PDB site
Description: thermostabilization of the bacillus circulans xylanase, by the introduction of disulfide bonds
Class: glycosidase
Keywords: glycosidase
Deposited on 1994-06-01, released 1994-12-20
The last revision prior to the SCOP 1.75 freeze date was dated 1994-12-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.171
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: Bacillus circulans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09850 (0-184)
      • conflict (99)
      • conflict (147)
    Domains in SCOP 1.75: d1xnca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xncA (A:)
    astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
    ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvkcdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitftchvnawkshgmnlgsnwayqvmategyqssgss
    nvtvw