PDB entry 1xnb

View 1xnb on RCSB PDB site
Description: high-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis
Class: glycosidase
Keywords: glycosidase
Deposited on 1994-06-01, released 1994-12-20
The last revision prior to the SCOP 1.73 freeze date was dated 1994-12-20, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.49 Å
R-factor: 0.165
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: Bacillus circulans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xnba_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xnbA (A:)
    astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
    ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
    nvtvw