PDB entry 1xna

View 1xna on RCSB PDB site
Description: nmr solution structure of the single-strand break repair protein xrcc1-n-terminal domain
Class: DNA binding protein
Keywords: xrcc1, 3d nmr, DNA repair, single-strand break DNA binding, DNA polymerase-beta binding, beta sandwich, DNA binding protein
Deposited on 1999-02-27, released 1999-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (DNA-repair protein xrcc1)
    Species: Homo sapiens [TaxId:9606]
    Gene: XRCC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xnaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xnaA (A:)
    mpeirlrhvvscssqdsthcaenllkadtyrkwraakagektisvvlqlekeeqihsvdi
    gndgsafvevlvgssaggageqdyevllvtssfmspsesrsgsnpnrvrmfgpdklvraa
    aekrwdrvkivcsqpyskdspfglsfvrfhsppdkdeaeapsqkvtvtklgqfrvkeeee
    san
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xnaA (A:)
    mpeirlrhvvscssqdsthcaenllkadtyrkwraakagektisvvlqlekeeqihsvdi
    gndgsafvevlvgssaggageqdyevllvtssfmspsesrsgsnpnrvrmfgpdklvraa
    aekrwdrvkivcsqpyskdspfglsfvrfhs