PDB entry 1xn9

View 1xn9 on RCSB PDB site
Description: solution structure of methanosarcina mazei protein rps24e: the northeast structural genomics consortium target mar11
Deposited on 2004-10-04, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1xn9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xn9A (A:)
  mdikiikdkknpllnrreldfivkyegstpsrndvrnklaamlnaplellviqrikteyg
  mqeskgyaklyedadrmkqveqeyvlkrnavpgsetegeea