PDB entry 1xn9

View 1xn9 on RCSB PDB site
Description: Solution Structure of Methanosarcina mazei Protein RPS24E: The Northeast Structural Genomics Consortium Target MaR11
Class: ribosome
Keywords: BETA+ALPHA, GFT NMR, Structural Genomics, Protein Structure Initiative, PSI, NESG, MAR11, Northeast Structural Genomics Consortium, RIBOSOME
Deposited on 2004-10-04, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S24e
    Species: Methanosarcina mazei [TaxId:2209]
    Gene: rps24e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xn9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xn9A (A:)
    mdikiikdkknpllnrreldfivkyegstpsrndvrnklaamlnaplellviqrikteyg
    mqeskgyaklyedadrmkqveqeyvlkrnavpgsetegeea