PDB entry 1xn8

View 1xn8 on RCSB PDB site
Description: Solution Structure of Bacillus subtilis Protein yqbG: The Northeast Structural Genomics Consortium Target SR215
Class: Structural Genomics, Unknown Function
Keywords: ALPHA, GFT NMR, Structural Genomics, Protein Structure Initiative, PSI, NESG, SR215, Northeast Structural Genomics Consortium, Unknown Function
Deposited on 2004-10-04, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein yqbG
  Species: Bacillus subtilis [TaxId:1423]
  Gene: yqbG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45923 (0-130)
    • see remark 999 (97)
  Domains in SCOPe 2.08: d1xn8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xn8A (A:)
  mllitpdelksysvfesvktrpdellkqdileatadiilkvghdfsdaeyiplpetvrla
  llklsqfyalingdesiikgyttekigdysytlgdgsslqkpdvyalikdyvkpadpdle
  gieakvrmrsi