PDB entry 1xn7

View 1xn7 on RCSB PDB site
Description: Solution Structure of E.Coli Protein yhgG: The Northeast Structural Genomics Consortium Target ET95
Class: Structural Genomics, Unknown function
Keywords: ALPHA+BETA, GFT NMR, Structural Genomics, Protein Structure Initiative, PSI, NESG, ET95, Northeast Structural Genomics Consortium, Unknown function
Deposited on 2004-10-04, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yhgG
    Species: Escherichia coli [TaxId:562]
    Gene: yhgG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xn7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xn7A (A:)
masliqvrdllalrgrmeaaqisqtlntpqpminamlqqlesmgkavriqeepdgclsgs
ckscpegkaclrewwalr