PDB entry 1xn6

View 1xn6 on RCSB PDB site
Description: Solution Structure of Northeast Structural Genomics Target Protein BcR68 encoded in gene Q816V6 of B. cereus
Class: structural genomics, unknown function
Keywords: Structural genomics, Protein Structure Initiative, PSI, NESG Target Protein BcR68, alpha + beta, GFT NMR, Northeast Structural Genomics Consortium, NESG
Deposited on 2004-10-04, released 2004-12-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein BC4709
  Species: BACILLUS CEREUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q816V6 (0-142)
  Domains in SCOP 1.73: d1xn6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xn6A (A:)
  meqqntlndikqtivfnasiqkvwsvvstaegiaswfmpndfvlevghefhvqspfgpsp
  ckvleidepnhlsfswdtdgwvvsfdlkdlgdnkteftlihggwkhpdeilpkanakssi
  irdrmsggwvaivneklkkvveg