PDB entry 1xn6

View 1xn6 on RCSB PDB site
Description: Solution Structure of Northeast Structural Genomics Target Protein BcR68 encoded in gene Q816V6 of B. cereus
Deposited on 2004-10-04, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xn6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xn6A (A:)
    meqqntlndikqtivfnasiqkvwsvvstaegiaswfmpndfvlevghefhvqspfgpsp
    ckvleidepnhlsfswdtdgwvvsfdlkdlgdnkteftlihggwkhpdeilpkanakssi
    irdrmsggwvaivneklkkvveg