PDB entry 1xn5

View 1xn5 on RCSB PDB site
Description: Solution Structure of Bacillus halodurans Protein BH1534: The Northeast Structural Genomics Consortium Target BhR29
Class: Structural Genomics, Unknown Function
Keywords: Structural genomics, Protein Structure Initiative, PSI, Bacillus halodurans Protein BH1534, alpha + beta, GFT NMR, NESG, Northeast Structural Genomics Consortium, Unknown Function
Deposited on 2004-10-04, released 2004-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BH1534 unknown conserved protein
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH1534
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xn5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xn5A (A:)
    mtrlpdikkevrfnapiekvweavstseglafwfmendlkaetghhfhlqspfgpspcqv
    tdverpiklsftwdtdgwsvtfhlkeeengtiftivhsgwkqgdtkvekagaesavvher
    mdrgwhdlvnerlrqivelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xn5A (A:)
    mtrlpdikkevrfnapiekvweavstseglafwfmendlkaetghhfhlqspfgpspcqv
    tdverpiklsftwdtdgwsvtfhlkeeengtiftivhsgwkqgdtkvekagaesavvher
    mdrgwhdlvnerlrqive