PDB entry 1xn4

View 1xn4 on RCSB PDB site
Description: putative mar1 ribonuclease from leishmania major
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, SGPP, PSI, Structural Genomics of Pathogenic Protozoa Consortium, UNKNOWN FUNCTION
Deposited on 2004-10-04, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.313
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease MAR1
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xn4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xn4A (A:)
    msrlmphyskgktaflcvdlqeafskrienfancvfvanrlarlhelvpentkyivtehy
    pkglgrivpgitlpqtahliektrfscivpqveelledvdnavvfgieghacilqtvadl
    ldmnkrvflpkdglgsqkktdfkaamklmgswspnceittsesillqmtkdamdpnfkki
    skllkeeppipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xn4A (A:)
    srlmphyskgktaflcvdlqeafskrienfancvfvanrlarlhelvpentkyivtehyp
    kglgrivpgitlpqtahliektrfscivpqveelledvdnavvfgieghacilqtvadll
    dmnkrvflpkdglgsqkktdfkaamklmgswspnceittsesillqmtkdamdpnfkkis
    kllkeeppipl