PDB entry 1xn1

View 1xn1 on RCSB PDB site
Description: Crystal Structure Of Lumazine Synthase From Brucella Abortus (Orthorhombic Form At 3.05 Angstroms)
Class: transferase
Keywords: transferase
Deposited on 2004-10-04, released 2005-09-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.199
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Brucella abortus [TaxId:235]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xn1a_
  • Chain 'B':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Brucella abortus [TaxId:235]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xn1b_
  • Chain 'C':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Brucella abortus [TaxId:235]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xn1c_
  • Chain 'D':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Brucella abortus [TaxId:235]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xn1d_
  • Chain 'E':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Brucella abortus [TaxId:235]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xn1e_
  • Chain 'F':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Brucella abortus [TaxId:235]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xn1f_
  • Chain 'G':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Brucella abortus [TaxId:235]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xn1g_
  • Chain 'H':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Brucella abortus [TaxId:235]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xn1h_
  • Chain 'I':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Brucella abortus [TaxId:235]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xn1i_
  • Chain 'J':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Brucella abortus [TaxId:235]
    Gene: ribH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xn1j_
  • Heterogens: PO4, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xn1A (A:)
    mnqscpnktsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplh
    aktlartgryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfh
    eskehhdffhahfkvkgveaahaalqivsersriaalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xn1A (A:)
    tsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartg
    ryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhdf
    fhahfkvkgveaahaalqivsersriaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xn1B (B:)
    mnqscpnktsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplh
    aktlartgryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfh
    eskehhdffhahfkvkgveaahaalqivsersriaalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xn1B (B:)
    sfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartgr
    yaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhdff
    hahfkvkgveaahaalqivsersriaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xn1C (C:)
    mnqscpnktsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplh
    aktlartgryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfh
    eskehhdffhahfkvkgveaahaalqivsersriaalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xn1C (C:)
    tsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartg
    ryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhdf
    fhahfkvkgveaahaalqivsersria
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xn1D (D:)
    mnqscpnktsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplh
    aktlartgryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfh
    eskehhdffhahfkvkgveaahaalqivsersriaalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xn1D (D:)
    tsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartg
    ryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhdf
    fhahfkvkgveaahaalqivsersria
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xn1E (E:)
    mnqscpnktsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplh
    aktlartgryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfh
    eskehhdffhahfkvkgveaahaalqivsersriaalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xn1E (E:)
    nktsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlar
    tgryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehh
    dffhahfkvkgveaahaalqivsersri
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xn1F (F:)
    mnqscpnktsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplh
    aktlartgryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfh
    eskehhdffhahfkvkgveaahaalqivsersriaalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xn1F (F:)
    tsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartg
    ryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhdf
    fhahfkvkgveaahaalqivsersriaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xn1G (G:)
    mnqscpnktsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplh
    aktlartgryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfh
    eskehhdffhahfkvkgveaahaalqivsersriaalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xn1G (G:)
    tsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartg
    ryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhdf
    fhahfkvkgveaahaalqivsersriaa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xn1H (H:)
    mnqscpnktsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplh
    aktlartgryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfh
    eskehhdffhahfkvkgveaahaalqivsersriaalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xn1H (H:)
    sfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartgr
    yaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhdff
    hahfkvkgveaahaalqivsersria
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1xn1I (I:)
    mnqscpnktsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplh
    aktlartgryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfh
    eskehhdffhahfkvkgveaahaalqivsersriaalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xn1I (I:)
    tsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartg
    ryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhdf
    fhahfkvkgveaahaalqivsersriaa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1xn1J (J:)
    mnqscpnktsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplh
    aktlartgryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfh
    eskehhdffhahfkvkgveaahaalqivsersriaalv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xn1J (J:)
    ktsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlart
    gryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhd
    ffhahfkvkgveaahaalqivsersri