PDB entry 1xmz

View 1xmz on RCSB PDB site
Description: Crystal structure of the dark state of kindling fluorescent protein kfp from anemonia sulcata
Class: luminescent protein
Keywords: fluorescent protein, chromophore structure, ascp595, luminescent protein
Deposited on 2004-10-04, released 2005-04-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.14
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GFP-like chromoprotein FP595
    Species: Anemonia sulcata [TaxId:6108]
    Database cross-references and differences (RAF-indexed):
    • GB AAG02385 (Start-242)
      • chromophore (75)
      • engineered (58)
    Domains in SCOPe 2.01: d1xmza_
  • Chain 'B':
    Compound: GFP-like chromoprotein FP595
    Species: Anemonia sulcata [TaxId:6108]
    Database cross-references and differences (RAF-indexed):
    • GB AAG02385 (11-242)
      • expression tag (7-11)
      • chromophore (75)
      • engineered (58)
    Domains in SCOPe 2.01: d1xmzb_
  • Heterogens: NH2, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmzA (A:)
    mrgshhhhhhgsasflkktmpfkttiegtvnghyfkctgkgegnpfegtqemkieviegg
    plpfafhilstscmygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdts
    ldgdclvykvkilgnnfpadgpvmqnkagrwepgteivyevdgvlrgqslmalkcpggrh
    ltchlhttyrskkpasalkmpgfhfedhrieimeevekgkcykqyeaavgrycdaapskl
    ghn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmzA (A:)
    flkktmpfkttiegtvnghyfkctgkgegnpfegtqemkievieggplpfafhilstscm
    ygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdtsldgdclvykvkilg
    nnfpadgpvmqnkagrwepgteivyevdgvlrgqslmalkcpggrhltchlhttyrskkp
    asalkmpgfhfedhrieimeevgkcykqyeaavgrycdaapsklghn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xmzB (B:)
    mrgshhhhhhgsasflkktmpfkttiegtvnghyfkctgkgegnpfegtqemkieviegg
    plpfafhilstscmygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdts
    ldgdclvykvkilgnnfpadgpvmqnkagrwepgteivyevdgvlrgqslmalkcpggrh
    ltchlhttyrskkpasalkmpgfhfedhrieimeevekgkcykqyeaavgrycdaapskl
    ghn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmzB (B:)
    hhhgsasflkktmpfkttiegtvnghyfkctgkgegnpfegtqemkievieggplpfafh
    ilstscmygsktfikyvsgipdyfkqsfpegftwertttyedggfltahqdtsldgdclv
    ykvkilgnnfpadgpvmqnkagrwepgteivyevdgvlrgqslmalkcpggrhltchlht
    tyrskkpasalkmpgfhfedhrieimeevgkcykqyeaavgrycdaapsklghn