PDB entry 1xmx

View 1xmx on RCSB PDB site
Description: Crystal structure of protein VC1899 from Vibrio cholerae
Class: structural genomics, unknown function
Keywords: alpha-beta, MCSG, protein structure initiative, Structural Genomics, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-10-04, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.173
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein VC1899
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQU9 (2-384)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1xmxa1, d1xmxa2
  • Heterogens: MG, GOL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmxA (A:)
    namaihvgiidqdpvrlvtplldhrtvsrhiifigdhtqtviyqrlsdvlnkrnistdff
    eipagsntsaiksairelaetlkargeevkfnascglrhrllsayevfrsyhwpifvvep
    nsdclcwlypegnndtqvqdritiadyltifgargefnehqlspqldqqlyqlgerwasn
    alelgpglatlnylattcrkeqkldvelsdkqqgyrelnlllsdlveakiasyengiltf
    ineearrfangewletlvhstvkqiqddmptiqdrslnvqvyrqlgerevrneldvatvv
    nnklhiiecktkgmrddgddtlykleslrdllgglqaramlvsfrplrhnditraedlgl
    aligpdelkdlkthltqwfkaaggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmxA (A:)
    namaihvgiidqdpvrlvtplldhrtvsrhiifigdhtqtviyqrlsdvlnkrnistdff
    eipagsntsaiksairelaetlkargeevkfnascglrhrllsayevfrsyhwpifvvep
    nsdclcwlypegnndtqvqdritiadyltifgargefnspqldqqlyqlgerwasnalel
    gpglatlnylattcrkeqkldvelsdkqqgyrelnlllsdlveakiasyengiltfinee
    arrfangewletlvhstvkqiqddmptiqdrslnvqvyrqlgerevrneldvatvvnnkl
    hiiecktkgmrdgddtlykleslrdllgglqaramlvsfrplrhnditraedlglaligp
    delkdlkthltqwfkaaggn