PDB entry 1xmt

View 1xmt on RCSB PDB site
Description: x-ray structure of gene product from arabidopsis thaliana at1g77540
Deposited on 2004-10-04, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.149
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xmta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xmtA (A:)
sateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
afehasshsisiipscsyvsdtflprnpswkplihsevfkssi

    Sequence, based on observed residues (ATOM records): (download) 
    >1xmtA (A:)
ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh
asshsisiipscsyvsdtflprnpswkplihsevf