PDB entry 1xmt

View 1xmt on RCSB PDB site
Description: X-ray structure of gene product from arabidopsis thaliana at1g77540
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, CESG, AT1G77540, PUTATIVE ACETYLTRANSFERASE, PSI, Center for Eukaryotic Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-10-04, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative acetyltransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g77540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xmta_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmtA (A:)
    sateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
    afehasshsisiipscsyvsdtflprnpswkplihsevfkssi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmtA (A:)
    ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh
    asshsisiipscsyvsdtflprnpswkplihsevf