PDB entry 1xms

View 1xms on RCSB PDB site
Description: "E. Coli RecA in complex with MnAMP-PNP"
Class: DNA binding protein
Keywords: RecA, homologous recombination, DNA Repair, ATPase, DNA-binding protein,, DNA BINDING PROTEIN
Deposited on 2004-10-04, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reca protein
    Species: Escherichia coli [TaxId:562]
    Gene: recA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xmsa1, d1xmsa2
  • Heterogens: MN, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmsA (A:)
    gshmaidenkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgaggl
    pmgriveiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllc
    sqpdtgeqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamr
    klagnlkqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegen
    vvgsetrvkvvknkiaapfkqaefqilygeginfygelvdlgvkekliekagawysykge
    kigqgkanatawlkdnpetakeiekkvrelllsnpnstpdfsvddsegvaetnedf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmsA (A:)
    denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
    eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
    eqaleicdalarsgavdvivvdsvaaltpkaeieaarmmsqamrklagnlkqsntllifi
    nqignalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqilygegi
    nfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelll