PDB entry 1xmr

View 1xmr on RCSB PDB site
Description: Crystal Structure of Thymidine Kinase with dTTP from U. urealyticum
Class: transferase
Keywords: deoxyribonucleoside kinase, zinc-binding domain, feed-back inhibitor, lasso-domain, dTTP, TK1, Uu-TK
Deposited on 2004-10-04, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2007-05-29, with a file datestamp of 2007-05-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: Ureaplasma urealyticum
    Gene: tdk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PPP5
      • engineered (35)
    Domains in SCOPe 2.08: d1xmra3, d1xmra4
  • Chain 'B':
    Compound: Thymidine kinase
    Species: Ureaplasma urealyticum
    Gene: tdk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PPP5
      • engineered (35)
    Domains in SCOPe 2.08: d1xmrb3, d1xmrb4
  • Chain 'C':
    Compound: Thymidine kinase
    Species: Ureaplasma urealyticum
    Gene: tdk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PPP5
      • engineered (35)
    Domains in SCOPe 2.08: d1xmrc3, d1xmrc4
  • Chain 'D':
    Compound: Thymidine kinase
    Species: Ureaplasma urealyticum
    Gene: tdk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PPP5
      • engineered (35)
    Domains in SCOPe 2.08: d1xmrd3, d1xmrd4
  • Heterogens: ZN, MG, TTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmrA (A:)
    mgsshhhhhhssglvprgshmakvnafskkigwiefitgpmfagktaelirrlhrleyad
    vkylvfkpkidtrsirniqsrtgtslpsvevesapeilnyimsnsfndetkvigidevqf
    fddricevanilaengfvviisgldknfkgepfgpiaklftyadkitkltaicnecgaea
    thslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnseefikffknkkrn
    kni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmrA (A:)
    igwiefitgpmfagktaelirrlhrleyadvkylvfkpkisvevesapeilnyimsnsfn
    detkvigidevqffddricevanilaengfvviisgldknfkgepfgpiaklftyadkit
    kltaicnecgaeathslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsns
    eefikffknk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xmrB (B:)
    mgsshhhhhhssglvprgshmakvnafskkigwiefitgpmfagktaelirrlhrleyad
    vkylvfkpkidtrsirniqsrtgtslpsvevesapeilnyimsnsfndetkvigidevqf
    fddricevanilaengfvviisgldknfkgepfgpiaklftyadkitkltaicnecgaea
    thslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnseefikffknkkrn
    kni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmrB (B:)
    igwiefitgpmfagktaelirrlhrleyadvkylvfkpkidtrsirniqsrtgtslpsve
    vesapeilnyimsnsfndetkvigidevqffddricevanilaengfvviisgldknfkg
    epfgpiaklftyadkitkltaicnecgaeathslrkidgkhadynddivkigcqefysav
    crhhhkvpnrpylnsnseefikffknk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xmrC (C:)
    mgsshhhhhhssglvprgshmakvnafskkigwiefitgpmfagktaelirrlhrleyad
    vkylvfkpkidtrsirniqsrtgtslpsvevesapeilnyimsnsfndetkvigidevqf
    fddricevanilaengfvviisgldknfkgepfgpiaklftyadkitkltaicnecgaea
    thslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnseefikffknkkrn
    kni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmrC (C:)
    igwiefitgpmfagktaelirrlhrleyadvkylvfkpkslpsvevesapeilnyimsns
    fndetkvigidevqffddricevanilaengfvviisgldknfkgepfgpiaklftyadk
    itkltaicnecgaeathslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylns
    nseefikffknk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xmrD (D:)
    mgsshhhhhhssglvprgshmakvnafskkigwiefitgpmfagktaelirrlhrleyad
    vkylvfkpkidtrsirniqsrtgtslpsvevesapeilnyimsnsfndetkvigidevqf
    fddricevanilaengfvviisgldknfkgepfgpiaklftyadkitkltaicnecgaea
    thslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnseefikffknkkrn
    kni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmrD (D:)
    igwiefitgpmfagktaelirrlhrleyadvkylvfkpkidtrsirniqsrtgtslpsve
    vesapeilnyimsnsfndetkvigidevqffddricevanilaengfvviisgldknfkg
    epfgpiaklftyadkitkltaicnecgaeathslrkidgkhadynddivkigcqefysav
    crhhhkvpnrpylnsnseefikffknk