PDB entry 1xmk

View 1xmk on RCSB PDB site
Description: The Crystal structure of the Zb domain from the RNA editing enzyme ADAR1
Class: hydrolase
Keywords: winged Helix-Turn-Helix, RNA editing, Interferon, ADAR1
Deposited on 2004-10-03, released 2005-08-02
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.145
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double-stranded RNA-specific adenosine deaminase
    Species: HOMO SAPIENS
    Gene: ADAR, ADAR1, DSRAD, IFI4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55265 (6-78)
      • cloning artifact (0-5)
    Domains in SCOP 1.73: d1xmka1
  • Heterogens: CD, NI, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xmkA (A:)
    gshmasldmaeikekicdylfnvsdssalnlaknigltkardinavlidmerqgdvyrqg
    ttppiwhltdkkrermqik