PDB entry 1xmd

View 1xmd on RCSB PDB site
Description: M335V mutant structure of mouse carnitine octanoyltransferase
Class: transferase
Keywords: carnitine, octanoyltransferase, hepes, mpd, mutant
Deposited on 2004-10-01, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal carnitine O-octanoyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Crot, Cot
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DC50 (Start-611)
      • engineered (334)
    Domains in SCOPe 2.07: d1xmda1, d1xmda2
  • Chain 'B':
    Compound: Peroxisomal carnitine O-octanoyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Crot, Cot
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DC50
      • engineered (334)
    Domains in SCOPe 2.07: d1xmdb1, d1xmdb2
  • Heterogens: EPE, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmdA (A:)
    menqltksveertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqe
    gagkrlhqkllerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegt
    qlergsmmlwhnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyf
    kteseghcpthiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaal
    tseertrwakareylisldpenltllekiqtslfvysiedssphatpeeysqvfemllgg
    dpsvrwgdksynlisfangifgcccdhapydamvvvniahyvdervletegrwkgsekvr
    diplpeelvftvdekilndvsqakaqhlkaasdlqiaastftsfgkkltkeealhpdtfi
    qlalqlayyrlhgrpgccyetamtryfyhgrtetvrsctveavrwcqsmqdpsasllerq
    qkmleafakhnkmmkdcshgkgfdrhllgllliakeeglpvpelfedplfsrsggggnfv
    lstslvgylrvqgvvvpmvhngygffyhirddrfvvacsswrscpetdaeklvqmifhaf
    hdmiqlmntahl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmdA (A:)
    ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl
    lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw
    hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt
    hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak
    areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks
    ynlisfangifgcccdhapydamvvvniahyvdervletegrwkgsekvrdiplpeelvf
    tvdekilndvsqakaqhlkaasdlqiaastftlhpdtfiqlalqlayyrlhgrpgccyet
    amtryfyhgrtetvrsctveavrwcqsmqdpsasllerqqkmleafakhnkmmkdcshgk
    gfdrhllgllliakeeglpvpelfedplfsrsggggnfvlstslvgylrvqgvvvpmvhn
    gygffyhirddrfvvacsswrscpetdaeklvqmifhafhdmiqlmntahl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xmdB (B:)
    menqltksveertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqe
    gagkrlhqkllerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegt
    qlergsmmlwhnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyf
    kteseghcpthiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaal
    tseertrwakareylisldpenltllekiqtslfvysiedssphatpeeysqvfemllgg
    dpsvrwgdksynlisfangifgcccdhapydamvvvniahyvdervletegrwkgsekvr
    diplpeelvftvdekilndvsqakaqhlkaasdlqiaastftsfgkkltkeealhpdtfi
    qlalqlayyrlhgrpgccyetamtryfyhgrtetvrsctveavrwcqsmqdpsasllerq
    qkmleafakhnkmmkdcshgkgfdrhllgllliakeeglpvpelfedplfsrsggggnfv
    lstslvgylrvqgvvvpmvhngygffyhirddrfvvacsswrscpetdaeklvqmifhaf
    hdmiqlmntahl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmdB (B:)
    ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl
    lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw
    hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt
    hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak
    areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks
    ynlisfangifgcccdhapydamvvvniahyvdervletegrwkgsekvrdiplpeelvf
    tvdekilndvsqakaqhlkaasdlqiaastftsfgkkltkeealhpdtfiqlalqlayyr
    lhgrpgccyetamtryfyhgrtetvrsctveavrwcqsmqdpsasllerqqkmleafakh
    nkmmkdcshgkgfdrhllgllliakeeglpvpelfedplfsrsggggnfvlstslvgylr
    vqgvvvpmvhngygffyhirddrfvvacsswrscpetdaeklvqmifhafhdmiqlmnta