PDB entry 1xmc

View 1xmc on RCSB PDB site
Description: C323M mutant structure of mouse carnitine octanoyltransferase
Class: transferase
Keywords: carnitine, octanoyltransferase, hepes, mpd, mutant
Deposited on 2004-10-01, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal carnitine O-octanoyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Crot, Cot
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DC50 (Start-611)
      • engineered (322)
    Domains in SCOPe 2.07: d1xmca1, d1xmca2
  • Chain 'B':
    Compound: Peroxisomal carnitine O-octanoyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Crot, Cot
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DC50
      • engineered (322)
    Domains in SCOPe 2.07: d1xmcb1, d1xmcb2
  • Heterogens: EPE, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmcA (A:)
    menqltksveertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqe
    gagkrlhqkllerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegt
    qlergsmmlwhnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyf
    kteseghcpthiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaal
    tseertrwakareylisldpenltllekiqtslfvysiedssphatpeeysqvfemllgg
    dpsvrwgdksynlisfangifgmccdhapydamvmvniahyvdervletegrwkgsekvr
    diplpeelvftvdekilndvsqakaqhlkaasdlqiaastftsfgkkltkeealhpdtfi
    qlalqlayyrlhgrpgccyetamtryfyhgrtetvrsctveavrwcqsmqdpsasllerq
    qkmleafakhnkmmkdcshgkgfdrhllgllliakeeglpvpelfedplfsrsggggnfv
    lstslvgylrvqgvvvpmvhngygffyhirddrfvvacsswrscpetdaeklvqmifhaf
    hdmiqlmntahl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmcA (A:)
    ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl
    lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw
    hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt
    hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak
    areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks
    ynlisfangifgmccdhapydamvmvniahyvdervletegrwkgsekvrdiplpeelvf
    tvdekilndvsqakaqhlkaasdlqiaastftlhpdtfiqlalqlayyrlhgrpgccyet
    amtryfyhgrtetvrsctveavrwcqsmqdpsasllerqqkmleafakhnkmmkdcshgk
    gfdrhllgllliakeeglpvpelfedplfsrsggggnfvlstslvgylrvqgvvvpmvhn
    gygffyhirddrfvvacsswrscpetdaeklvqmifhafhdmiqlmntahl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xmcB (B:)
    menqltksveertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqe
    gagkrlhqkllerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegt
    qlergsmmlwhnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyf
    kteseghcpthiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaal
    tseertrwakareylisldpenltllekiqtslfvysiedssphatpeeysqvfemllgg
    dpsvrwgdksynlisfangifgmccdhapydamvmvniahyvdervletegrwkgsekvr
    diplpeelvftvdekilndvsqakaqhlkaasdlqiaastftsfgkkltkeealhpdtfi
    qlalqlayyrlhgrpgccyetamtryfyhgrtetvrsctveavrwcqsmqdpsasllerq
    qkmleafakhnkmmkdcshgkgfdrhllgllliakeeglpvpelfedplfsrsggggnfv
    lstslvgylrvqgvvvpmvhngygffyhirddrfvvacsswrscpetdaeklvqmifhaf
    hdmiqlmntahl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmcB (B:)
    ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl
    lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw
    hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt
    hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak
    areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks
    ynlisfangifgmccdhapydamvmvniahyvdervletegrwkgsekvrdiplpeelvf
    tvdekilndvsqakaqhlkaasdlqiaastftsfgkkltkeealhpdtfiqlalqlayyr
    lhgrpgccyetamtryfyhgrtetvrsctveavrwcqsmqdpsasllerqqkmleafakh
    nkmmkdcshgkgfdrhllgllliakeeglpvpelfedplfsrsggggnfvlstslvgylr
    vqgvvvpmvhngygffyhirddrfvvacsswrscpetdaeklvqmifhafhdmiqlmnta