PDB entry 1xm8

View 1xm8 on RCSB PDB site
Description: x-ray structure of glyoxalase II from arabidopsis thaliana gene at2g31350
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, CESG, AT2G31350, METALLO-HYDROLASE, ZINC/IRON BINUCLEAR CENTER, B-LACTAMASE FOLD, THIOESTER HYDROLASE, mitochondrial isozyme, Center for Eukaryotic Structural Genomics, HYDROLASE
Deposited on 2004-10-01, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyoxalase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g31350
    Database cross-references and differences (RAF-indexed):
    • GB AAM20306 (0-253)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1xm8a1, d1xm8a2
  • Chain 'B':
    Compound: glyoxalase II
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g31350
    Database cross-references and differences (RAF-indexed):
    • GB AAM20306 (0-253)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1xm8b1, d1xm8b2
  • Heterogens: ZN, FE, ACY, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xm8A (A:)
    mqielvpclkdnyayilhdedtgtvgvvdpseaepiidslkrsgrnltyilnthhhydht
    ggnlelkdrygakvigsamdkdripgidmalkdgdkwmfaghevhvmdtpghtkghisly
    fpgsraiftgdtmfslscgklfegtpkqmlaslqkitslpddtsiycgheytlsnskfal
    slepnnevlqsyaahvaelrskklptipttvkmekacnpflrssntdirralripeaade
    aealgiirkakddf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xm8B (B:)
    mqielvpclkdnyayilhdedtgtvgvvdpseaepiidslkrsgrnltyilnthhhydht
    ggnlelkdrygakvigsamdkdripgidmalkdgdkwmfaghevhvmdtpghtkghisly
    fpgsraiftgdtmfslscgklfegtpkqmlaslqkitslpddtsiycgheytlsnskfal
    slepnnevlqsyaahvaelrskklptipttvkmekacnpflrssntdirralripeaade
    aealgiirkakddf