PDB entry 1xm7

View 1xm7 on RCSB PDB site
Description: The Crystal Structure of the Protein of Unknown Function AQ665 from Aquifex aeolicus
Class: Structural genomics, unknown function
Keywords: Structural genomics, protein_aq1665, protein structure initiative, midwest center for structural genomics, PSI, MCSG, unknown function
Deposited on 2004-10-01, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein aq_1665
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67582 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1xm7a1, d1xm7a2
  • Chain 'B':
    Compound: hypothetical protein aq_1665
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67582 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1xm7b1, d1xm7b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xm7A (A:)
    nammyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndk
    neylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpi
    terypdrqemvreiyfkencdllihghvhwnregikcackdyriecinanvewndykpis
    ereidklisyekakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm7A (A:)
    nammyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndk
    neylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpi
    terypdrqemvreiyfkencdllihghvhwnregcackdyriecinanvewndykpiser
    eidkli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xm7B (B:)
    nammyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndk
    neylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpi
    terypdrqemvreiyfkencdllihghvhwnregikcackdyriecinanvewndykpis
    ereidklisyekakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm7B (B:)
    nammyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndk
    neylriwkalpgrkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpi
    terypdrqemvreiyfkencdllihghvhwnregcackdyriecinanvewndykpiser
    eidkli