PDB entry 1xm3

View 1xm3 on RCSB PDB site
Description: Crystal structure of Northeast Structural Genomics Target SR156
Class: biosynthetic protein
Keywords: X-Ray structure, Structural Genomics, Protein Structure Initiative, PSI, NESG, Northeast Structural Genomics Consortium, BIOSYNTHETIC PROTEIN
Deposited on 2004-10-01, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiazole biosynthesis protein thiG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: thiG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31618
      • modified residue (2)
      • modified residue (46)
      • modified residue (95)
      • modified residue (151)
      • modified residue (196)
      • modified residue (218)
      • modified residue (222)
    Domains in SCOPe 2.07: d1xm3a_
  • Chain 'B':
    Compound: Thiazole biosynthesis protein thiG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: thiG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31618
      • modified residue (2)
      • modified residue (46)
      • modified residue (95)
      • modified residue (151)
      • modified residue (196)
      • modified residue (218)
      • modified residue (222)
    Domains in SCOPe 2.07: d1xm3b_
  • Chain 'C':
    Compound: Thiazole biosynthesis protein thiG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: thiG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31618
      • modified residue (2)
      • modified residue (46)
      • modified residue (95)
      • modified residue (151)
      • modified residue (196)
      • modified residue (218)
      • modified residue (222)
    Domains in SCOPe 2.07: d1xm3c_
  • Chain 'D':
    Compound: Thiazole biosynthesis protein thiG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: thiG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31618
      • modified residue (2)
      • modified residue (46)
      • modified residue (95)
      • modified residue (151)
      • modified residue (196)
      • modified residue (218)
      • modified residue (222)
    Domains in SCOPe 2.07: d1xm3d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xm3A (A:)
    msmltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleq
    ldlskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkase
    qlleegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvp
    vivdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagrip
    lkqygtasspgeglpvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm3A (A:)
    smltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifleqldlskytl
    lpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseqlleegfi
    vlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvivdagig
    spkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagriplkqygtas
    spge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xm3B (B:)
    msmltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleq
    ldlskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkase
    qlleegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvp
    vivdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagrip
    lkqygtasspgeglpvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm3B (B:)
    smltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleql
    dlskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseq
    lleegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpv
    ivdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagripl
    kqygtasspge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xm3C (C:)
    msmltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleq
    ldlskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkase
    qlleegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvp
    vivdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagrip
    lkqygtasspgeglpvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm3C (C:)
    smltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleql
    dlskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseq
    lleegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpv
    ivdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagripl
    kqygtassp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xm3D (D:)
    msmltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleq
    ldlskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkase
    qlleegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvp
    vivdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagrip
    lkqygtasspgeglpvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm3D (D:)
    smltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleql
    dlskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseq
    lleegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpv
    ivdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagripl
    kqygtassp