PDB entry 1xm2

View 1xm2 on RCSB PDB site
Description: Crystal structure of Human PRL-1
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-10-01, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.237
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93096
      • modified residue (16)
      • engineered (103)
      • modified residue (123)
      • modified residue (155)
    Domains in SCOPe 2.07: d1xm2a_
  • Chain 'B':
    Compound: tyrosine phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93096
      • modified residue (16)
      • engineered (103)
      • modified residue (123)
      • modified residue (155)
    Domains in SCOPe 2.07: d1xm2b_
  • Chain 'C':
    Compound: tyrosine phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93096
      • modified residue (16)
      • engineered (103)
      • modified residue (123)
      • modified residue (155)
    Domains in SCOPe 2.07: d1xm2c_
  • Chain 'D':
    Compound: tyrosine phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93096
      • modified residue (16)
      • engineered (103)
      • modified residue (123)
      • modified residue (155)
    Domains in SCOPe 2.07: d1xm2d_
  • Chain 'E':
    Compound: tyrosine phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93096
      • modified residue (16)
      • engineered (103)
      • modified residue (123)
      • modified residue (155)
    Domains in SCOPe 2.07: d1xm2e_
  • Chain 'F':
    Compound: tyrosine phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93096
      • modified residue (16)
      • engineered (103)
      • modified residue (123)
      • modified residue (155)
    Domains in SCOPe 2.07: d1xm2f_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xm2A (A:)
    marmnrpapvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvek
    egihvldwpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalali
    eggmkyedavqfirqkrrgafnskqllylekyrpkmrlrfkdsnghrnncciq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm2A (A:)
    apvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvld
    wpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalalieggmkye
    davqfirqkrrgafnskqllylekyrpkm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xm2B (B:)
    marmnrpapvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvek
    egihvldwpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalali
    eggmkyedavqfirqkrrgafnskqllylekyrpkmrlrfkdsnghrnncciq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm2B (B:)
    apvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvld
    wpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalalieggmkye
    davqfirqkrrgafnskqllylekyrpkm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xm2C (C:)
    marmnrpapvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvek
    egihvldwpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalali
    eggmkyedavqfirqkrrgafnskqllylekyrpkmrlrfkdsnghrnncciq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm2C (C:)
    apvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvld
    wpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalalieggmkye
    davqfirqkrrgafnskqllylekyrpkm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xm2D (D:)
    marmnrpapvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvek
    egihvldwpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalali
    eggmkyedavqfirqkrrgafnskqllylekyrpkmrlrfkdsnghrnncciq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm2D (D:)
    apvevtyknmrflithnpatlnkfieelkkygvttivrvcedttlvekegihvldwpfdd
    gappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalalieggmkyedavqf
    irqkrrgafnskqllylekyrpkm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xm2E (E:)
    marmnrpapvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvek
    egihvldwpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalali
    eggmkyedavqfirqkrrgafnskqllylekyrpkmrlrfkdsnghrnncciq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm2E (E:)
    apvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvld
    wpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalalieggmkye
    davqfirqkrrgafnskqllylekyrpkm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xm2F (F:)
    marmnrpapvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvek
    egihvldwpfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalali
    eggmkyedavqfirqkrrgafnskqllylekyrpkmrlrfkdsnghrnncciq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm2F (F:)
    apvevtyknmrflithnpatlnkfieelkkygvttivrvceatydttlvekegihvldwp
    fddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalalieggmkyeda
    vqfirqkrrgafnskqllylekyrpkm