PDB entry 1xm0

View 1xm0 on RCSB PDB site
Description: Solution NMR Structure of Methionine Sulfoxide Reductase B Using Minimal Constraint Strategy; Northeast Structural Genomics Target SR10
Class: oxidoreductase
Keywords: beta barrel decorated by five short helices, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, OXIDOREDUCTASE
Deposited on 2004-09-30, released 2005-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide methionine sulfoxide reductase msrB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: msrB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54155 (0-142)
      • cloning artifact (143-146)
    Domains in SCOPe 2.07: d1xm0a2, d1xm0a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xm0A (A:)
    maynkeekikslnrmqyevtqnngteppfqneywdhkeeglyvdivsgkplftskdkfds
    qcgwpsftkpieeeveekldtshgmirtevrsrtadshlghvfndgpgpnglrycinsaa
    lrfvpkhklkeegyesylhlfnklehh