PDB entry 1xls

View 1xls on RCSB PDB site
Description: Crystal structure of the mouse CAR/RXR LBD heterodimer bound to TCPOBOP and 9cRA and a TIF2 peptide containg the third LXXLL motifs
Class: transcription
Keywords: LBD, nuclear receptor, CAR, xenobiotic, TRANSCRIPTION
Deposited on 2004-09-30, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Human
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xlsa_
  • Chain 'B':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Human
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xlsb_
  • Chain 'C':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Human
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xlsc_
  • Chain 'D':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Human
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xlsd_
  • Chain 'E':
    Compound: Orphan nuclear receptor NR1I3
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35627 (0-241)
      • conflict (29)
    Domains in SCOPe 2.07: d1xlse_
  • Chain 'F':
    Compound: Orphan nuclear receptor NR1I3
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35627 (0-241)
      • conflict (29)
    Domains in SCOPe 2.07: d1xlsf_
  • Chain 'G':
    Compound: Orphan nuclear receptor NR1I3
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35627 (0-241)
      • conflict (29)
    Domains in SCOPe 2.07: d1xlsg_
  • Chain 'H':
    Compound: Orphan nuclear receptor NR1I3
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35627 (0-241)
      • conflict (29)
    Domains in SCOPe 2.07: d1xlsh_
  • Chain 'I':
    Compound: nuclear receptor coactivator 2
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUI9 (0-End)
      • conflict (0)
  • Chain 'J':
    Compound: nuclear receptor coactivator 2
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUI9 (0-End)
      • conflict (0)
  • Chain 'K':
    Compound: nuclear receptor coactivator 2
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUI9 (0-End)
      • conflict (0)
  • Chain 'L':
    Compound: nuclear receptor coactivator 2
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUI9 (0-End)
      • conflict (0)
  • Chain 'M':
    Compound: nuclear receptor coactivator 2
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUI9 (0-17)
      • conflict (0)
  • Chain 'N':
    Compound: nuclear receptor coactivator 2
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUI9 (0-17)
      • conflict (0)
  • Chain 'O':
    Compound: nuclear receptor coactivator 2
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUI9 (0-17)
      • conflict (0)
  • Chain 'P':
    Compound: nuclear receptor coactivator 2
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUI9 (0-17)
      • conflict (0)
  • Heterogens: 9CR, TCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xlsA (A:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xlsB (B:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xlsC (C:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xlsD (D:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xlsE (E:)
    nqqqkelvqillgahtrhvgplfdqfvqfrppaylfmhhrpfqprgpvlpllthfadint
    fmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykm
    edavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqe
    emalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrleelsamtpllgei
    cs
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xlsF (F:)
    nqqqkelvqillgahtrhvgplfdqfvqfrppaylfmhhrpfqprgpvlpllthfadint
    fmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykm
    edavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqe
    emalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrleelsamtpllgei
    cs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xlsG (G:)
    nqqqkelvqillgahtrhvgplfdqfvqfrppaylfmhhrpfqprgpvlpllthfadint
    fmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykm
    edavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqe
    emalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrleelsamtpllgei
    cs
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xlsH (H:)
    nqqqkelvqillgahtrhvgplfdqfvqfrppaylfmhhrpfqprgpvlpllthfadint
    fmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykm
    edavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqe
    emalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrleelsamtpllgei
    cs
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.