PDB entry 1xlr

View 1xlr on RCSB PDB site
Description: chorismate lyase with inhibitor vanillate
Class: lyase
Keywords: secondary inhibitor site, LYASE
Deposited on 2004-09-30, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chorismate--pyruvate lyase
    Species: Escherichia coli [TaxId:562]
    Gene: ubiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26602 (0-163)
      • engineered mutation (13)
      • engineered mutation (80)
      • engineered mutation (89)
    Domains in SCOPe 2.07: d1xlra_
  • Heterogens: VNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xlrA (A:)
    shpaltqlralryskeipaldpqlldwllledsmtkrfeqqgktvsvtmiregfveqnei
    peelpllpkesrywlreillsadgepwlaartvvpvstlsgpelalqklgktplgrylft
    sstltrdfieigrdaglwgrrsrlrlsgkpllltelflpasply