PDB entry 1xlp

View 1xlp on RCSB PDB site
Description: Structure of oxidized C73S putidaredoxin from Pseudomonas putida
Class: oxidoreductase
Keywords: [2Fe-2S], ferredoxin, OXIDOREDUCTASE
Deposited on 2004-09-30, released 2005-10-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-105)
      • engineered (72)
    Domains in SCOPe 2.03: d1xlpa_
  • Chain 'B':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-105)
      • engineered (72)
    Domains in SCOPe 2.03: d1xlpb_
  • Chain 'C':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-105)
      • engineered (72)
    Domains in SCOPe 2.03: d1xlpc_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xlpA (A:)
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xlpB (B:)
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xlpC (C:)
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw