PDB entry 1xlo

View 1xlo on RCSB PDB site
Description: Structure of reduced C73S/C85S putidaredoxin, a [2Fe-2S] ferredoxin from Pseudomonas putida
Class: oxidoreductase
Keywords: [2Fe-2S], ferredoxin, OXIDOREDUCTASE
Deposited on 2004-09-30, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.23
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-105)
      • engineered (72)
      • engineered (84)
    Domains in SCOPe 2.07: d1xloa_
  • Chain 'B':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-105)
      • engineered (72)
      • engineered (84)
    Domains in SCOPe 2.07: d1xlob_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xloA (A:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xloB (B:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw