PDB entry 1xlm

View 1xlm on RCSB PDB site
Description: d254e, d256e mutant of d-xylose isomerase complexed with al3 and xylitol
Class: isomerase
Keywords: isomerase, al, substrate induced metal ion movement, xylose metabolism, pentose shunt
Deposited on 1997-07-22, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.179
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-xylose isomerase
    Species: Arthrobacter sp. NRRL [TaxId:1669]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12070 (Start-393)
      • engineered (253)
      • engineered (255)
    Domains in SCOPe 2.07: d1xlma_
  • Chain 'B':
    Compound: d-xylose isomerase
    Species: Arthrobacter sp. NRRL [TaxId:1669]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12070 (Start-393)
      • engineered (253)
      • engineered (255)
    Domains in SCOPe 2.07: d1xlmb_
  • Heterogens: XYL, AL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xlmA (A:)
    svqptpadhftfglwtvgwtgadpfgvatrknldpveavhklaelgaygitfhdndlipf
    dateaerekilgdfnqalkdtglkvpmvttnlfshpvfkdggftsndrsirrfalakvlh
    nidlaaemgaetfvmwggregseydgskdlaaaldrmregvdtaagyikdkgynlriale
    pkpneprgdiflptvghglafieqlehgdivglnpetgheqmaglnfthgiaqalwaekl
    fhidlngqrgikyeqelvfghgdltsafftvdllengfpnggpkytgprhfdykpsrtdg
    ydgvwdsakanmsmylllkeralafradpevqeamktsgvfelgettlnagesaadlmnd
    sasfagfdaeaaaernfafirlnqlaiehllgsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xlmA (A:)
    vqptpadhftfglwtvgwtgadpfgvatrknldpveavhklaelgaygitfhdndlipfd
    ateaerekilgdfnqalkdtglkvpmvttnlfshpvfkdggftsndrsirrfalakvlhn
    idlaaemgaetfvmwggregseydgskdlaaaldrmregvdtaagyikdkgynlrialep
    kpneprgdiflptvghglafieqlehgdivglnpetgheqmaglnfthgiaqalwaeklf
    hidlngqrgikyeqelvfghgdltsafftvdllengfpnggpkytgprhfdykpsrtdgy
    dgvwdsakanmsmylllkeralafradpevqeamktsgvfelgettlnagesaadlmnds
    asfagfdaeaaaernfafirlnqlaiehllgsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xlmB (B:)
    svqptpadhftfglwtvgwtgadpfgvatrknldpveavhklaelgaygitfhdndlipf
    dateaerekilgdfnqalkdtglkvpmvttnlfshpvfkdggftsndrsirrfalakvlh
    nidlaaemgaetfvmwggregseydgskdlaaaldrmregvdtaagyikdkgynlriale
    pkpneprgdiflptvghglafieqlehgdivglnpetgheqmaglnfthgiaqalwaekl
    fhidlngqrgikyeqelvfghgdltsafftvdllengfpnggpkytgprhfdykpsrtdg
    ydgvwdsakanmsmylllkeralafradpevqeamktsgvfelgettlnagesaadlmnd
    sasfagfdaeaaaernfafirlnqlaiehllgsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xlmB (B:)
    vqptpadhftfglwtvgwtgadpfgvatrknldpveavhklaelgaygitfhdndlipfd
    ateaerekilgdfnqalkdtglkvpmvttnlfshpvfkdggftsndrsirrfalakvlhn
    idlaaemgaetfvmwggregseydgskdlaaaldrmregvdtaagyikdkgynlrialep
    kpneprgdiflptvghglafieqlehgdivglnpetgheqmaglnfthgiaqalwaeklf
    hidlngqrgikyeqelvfghgdltsafftvdllengfpnggpkytgprhfdykpsrtdgy
    dgvwdsakanmsmylllkeralafradpevqeamktsgvfelgettlnagesaadlmnds
    asfagfdaeaaaernfafirlnqlaiehllgsr