PDB entry 1xl9

View 1xl9 on RCSB PDB site
Description: Crystal Structure of Dihydrodipicolinate Synthase DapA-2 (BA3935) from Bacillus Anthracis.
Class: lyase
Keywords: dihydrodipicolinate synthase; TIM barrel; crystal structure; lysine biosynthesis; SPINE, LYASE
Deposited on 2004-09-30, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.197
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodipicolinate synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: DapA-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xl9a_
  • Chain 'B':
    Compound: Dihydrodipicolinate synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: DapA-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xl9b_
  • Chain 'C':
    Compound: Dihydrodipicolinate synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: DapA-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xl9c_
  • Chain 'D':
    Compound: Dihydrodipicolinate synthase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: DapA-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xl9d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xl9A (A:)
    gsshhhhhhmidfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesp
    tltseekvalyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynk
    psqegmyqhfkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvlt
    mteiiektaddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkka
    qklhqllvrvtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsip
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xl9A (A:)
    midfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesptltseekva
    lyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynkpsqegmyqh
    fkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvltmteiiekta
    ddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkkaqklhqllvr
    vtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsipr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xl9B (B:)
    gsshhhhhhmidfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesp
    tltseekvalyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynk
    psqegmyqhfkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvlt
    mteiiektaddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkka
    qklhqllvrvtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsip
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xl9B (B:)
    midfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesptltseekva
    lyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynkpsqegmyqh
    fkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvltmteiiekta
    ddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkkaqklhqllvr
    vtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsipr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xl9C (C:)
    gsshhhhhhmidfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesp
    tltseekvalyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynk
    psqegmyqhfkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvlt
    mteiiektaddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkka
    qklhqllvrvtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsip
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xl9C (C:)
    midfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesptltseekva
    lyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynkpsqegmyqh
    fkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvltmteiiekta
    ddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkkaqklhqllvr
    vtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsipr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xl9D (D:)
    gsshhhhhhmidfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesp
    tltseekvalyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynk
    psqegmyqhfkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvlt
    mteiiektaddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkka
    qklhqllvrvtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsip
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xl9D (D:)
    midfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesptltseekva
    lyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynkpsqegmyqh
    fkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvltmteiiekta
    ddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkkaqklhqllvr
    vtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsipr